PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI04G17360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 360aa    MW: 37343.9 Da    PI: 9.7591
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI04G17360.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.21.5e-40107183177
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +CqvegC+  l+ +keyhrrhkvCevh+kap v+v+g+eqrfCqqCsrfh l efD++k+sCrrrLa+hnerrr+++
  OMERI04G17360.1 107 RCQVEGCDITLQGVKEYHRRHKVCEVHAKAPRVVVHGTEQRFCQQCSRFHVLAEFDDAKKSCRRRLAGHNERRRRSN 183
                      6*************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114132.693105182IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.107.9E-34105169IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.32E-39106185IPR004333Transcription factor, SBP-box
PfamPF031103.3E-32108181IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MEGNGSGGSG ATPRGVIGMH WAPVVTSPPS PQPPFLPPAP CRPDVQMQQQ GGLTCLKLGK  60
RPCFWGGDGA GQVAQGSGGG GGGGGGGSAD QGKRKEKAAT AVPVVPRCQV EGCDITLQGV  120
KEYHRRHKVC EVHAKAPRVV VHGTEQRFCQ QCSRFHVLAE FDDAKKSCRR RLAGHNERRR  180
RSNASEAMAR GSAHPHGMPV LGHGFPPYGL PTSSAGALSL LSSARATGPW LIPTPDISAR  240
SSAALDELIA ENRAALLSWQ FFSDRQPPPA GRPTGRSPGS ETAGGWHAHL QARPPPSGAG  300
GQHEHQSGHV TLDLMQATTA AGGSGAPFRP VPARPAKEGG DAGCTSDAWT SSPMEGARVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-311081811184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17687SGGGGGGGGGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0687490.0AK068749.1 Oryza sativa Japonica Group cDNA clone:J013158C23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635344.10.0PREDICTED: squamosa promoter-binding-like protein 7
SwissprotQ01JD10.0SPL7_ORYSI; Squamosa promoter-binding-like protein 7
TrEMBLA0A0E0DGT70.0A0A0E0DGT7_9ORYZ; Uncharacterized protein
STRINGORGLA04G0180000.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP103033439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.16e-35squamosa promoter binding protein-like 3